Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4N2 (OR4N2)

This Recombinant Human Olfactory receptor 4N2 (OR4N2) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 4N2, Olfactory receptor OR14-13, Olfactory receptor OR14-8

UniProt

Q8NGD1

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESENRTVIREFILLGLTQSQDIQLLVFVLVLIFYFIILPGNFLIIFTIKSDPGLTAPLY FFLGNLAFLDASYSFIVAPRMLVDFLSAKKIISYRGCITQLFFLHFLGGGEGLLLVVMAF DRYIAICRPLHYPTVMNPRTCYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD VPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCRIRGSSSEAKNKAMSTC ITHIIVIFFMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKK VFNKHIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smim19 Mouse Gene Knockout Kit (CRISPR)
KN516323 1 Kit

Smim19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Them6 (NM_198607) Mouse Tagged ORF Clone
MG202196 10 µg

Them6 (NM_198607) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF488A conjugate, 0.1mg/mL
BNC882375-500 1x 500 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MARCHF9 Rabbit Polyclonal Antibody
TA373090 100 µL

MARCHF9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), CF647 conjugate, 0.1mg/mL
BNC471370-500 1x 500 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AGXT (NM_000030) Human Over-expression Lysate
LY424964 100 µg

AGXT (NM_000030) Human Over-expression Lysate

Sign In for Pricing
View Details