Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5M3 (OR5M3)

This Recombinant Human Olfactory receptor 5M3 (OR5M3) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 5M3, Olfactory receptor OR11-191

UniProt

Q8NGP4

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNFTDVTEFILLGLTSRREWQVLFFIIFLVVYIITMVGNIGMMVLIKVSPQLNNPMYFF LSHLSFVDVWFSSNVTPKMLENLLSDKKTITYAGCLVQCFFFIALVHVEIFILAAMAFDR YMAIGNPLLYGSKMSRVVCIRLITFPYIYGFLTSLAATLWTYGLYFCGKIEINHFYCADP PLIKMACAGTFVKEYTMIILAGINFTYSLTVIIISYLFILIAILRMRSAEGRQKAFSTCG SHLTAVIIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKKAMM KVISRSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM10 Rabbit pAb
E45R25824N 50 ul

MCM10 Rabbit pAb

Sign In for Pricing
View Details
Kinesis PEEK Nut 1/16 SF 5/16-24
CHR5341 1 Each

Kinesis PEEK Nut 1/16 SF 5/16-24

Sign In for Pricing
View Details
AGO4A Antibody
orb838224 2 mg

AGO4A Antibody

Sign In for Pricing
View Details
DCN Polyclonal Antibody
RD77385A-01 20 µL

DCN Polyclonal Antibody

Sign In for Pricing
View Details
DCN Polyclonal Antibody
RD77385A-02 60 μL

DCN Polyclonal Antibody

Sign In for Pricing
View Details
DCN Polyclonal Antibody
RD77385A-03 120 μL

DCN Polyclonal Antibody

Sign In for Pricing
View Details