Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8K5 (OR8K5)

This Recombinant Human Olfactory receptor 8K5 (OR8K5) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 8K5, Olfactory receptor OR11-174

UniProt

Q8NH50

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQHNLTVLTEFILMELTRRPELQIPLFGVFLVIYLITVVGNLTMIILTKLDSHLHTPMY FSIRHLAFVDLGNSTVICPKVLANFVVDRNTISYYACAAQLAFFLMFIISEFFILSAMAY DRYVAICNPLLYYVIMSQRLCHVLVGIQYLYSTFQALMFTIKIFTLTFCGSNVISHFYCD DVPLLPMLCSNAQEIELLSILFSVFNLISSFLIVLVSYMLILLAICQMHSAEGRKKAFST CGSHLTVVVVFYGSLLFMYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNA FYKLFEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd8a (BC030679) Mouse Tagged ORF Clone
MG202198 10 µg

Cd8a (BC030679) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Pvalb Mouse Gene Knockout Kit (CRISPR)
KN514265 1 Kit

Pvalb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C9]
TA804411BM 100 µL

IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C9]

Sign In for Pricing
View Details
APC Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381E-01 20 Tests

APC Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details
APC Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381E-02 100 Tests

APC Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details
APC Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381E-03 2x 100 Tests

APC Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details