Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8K5 (OR8K5)

This Recombinant Human Olfactory receptor 8K5 (OR8K5) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 8K5, Olfactory receptor OR11-174

UniProt

Q8NH50

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQHNLTVLTEFILMELTRRPELQIPLFGVFLVIYLITVVGNLTMIILTKLDSHLHTPMY FSIRHLAFVDLGNSTVICPKVLANFVVDRNTISYYACAAQLAFFLMFIISEFFILSAMAY DRYVAICNPLLYYVIMSQRLCHVLVGIQYLYSTFQALMFTIKIFTLTFCGSNVISHFYCD DVPLLPMLCSNAQEIELLSILFSVFNLISSFLIVLVSYMLILLAICQMHSAEGRKKAFST CGSHLTVVVVFYGSLLFMYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNA FYKLFEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesothelin (MSLN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7C2]
TA814168BM 100 µL

Mesothelin (MSLN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7C2]

Sign In for Pricing
View Details
TGM1 (NM_000359) Human Over-expression Lysate
LC424776 20 µg

TGM1 (NM_000359) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant XLF Antibody
RC-16032-01 50 μL

Recombinant XLF Antibody

Sign In for Pricing
View Details
Recombinant XLF Antibody
RC-16032-02 100 µL

Recombinant XLF Antibody

Sign In for Pricing
View Details
Recombinant XLF Antibody
RC-16032-03 1 mL

Recombinant XLF Antibody

Sign In for Pricing
View Details
TYK2 (NM_003331) Human Recombinant Protein
TP304351 20 µg

TYK2 (NM_003331) Human Recombinant Protein

Sign In for Pricing
View Details