Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 35 (Gpr35)

This Recombinant Mouse G-protein coupled receptor 35 (Gpr35) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

G-protein coupled receptor 35, Kynurenic acid receptor, KYNA receptor

UniProt

Q9ES90

Expression Region

1-307

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYRMHQWTETRIYMTNLA VADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISLVTAIAVDRYVAVRHPL RARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSSQTRRNFSTTAFSLLGFY LPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANLAVFVICFLPLHVVLTVQV SLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMAREFQEASKPATSSNTPHKSQD SQILSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NAL12 (His)
orb3067922 50 µg

Recombinant Human NAL12 (His)

Sign In for Pricing
View Details
Anti-Annexin V (ANXA5) Polyclonal antibody
FY-AB34978-01 1 mL

Anti-Annexin V (ANXA5) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Annexin V (ANXA5) Polyclonal antibody
FY-AB34978-02 100 µL

Anti-Annexin V (ANXA5) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Annexin V (ANXA5) Polyclonal antibody
FY-AB34978-03 200 µL

Anti-Annexin V (ANXA5) Polyclonal antibody

Sign In for Pricing
View Details
FXR1 (NM_001013438) Human Over-expression Lysate
LH03928V 100 µg

FXR1 (NM_001013438) Human Over-expression Lysate

Sign In for Pricing
View Details
Rfxank (NM_001025589) Mouse Recombinant Protein
E45M47807M5 20 µg

Rfxank (NM_001025589) Mouse Recombinant Protein

Sign In for Pricing
View Details