Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 35 (Gpr35)

This Recombinant Mouse G-protein coupled receptor 35 (Gpr35) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

G-protein coupled receptor 35, Kynurenic acid receptor, KYNA receptor

UniProt

Q9ES90

Expression Region

1-307

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYRMHQWTETRIYMTNLA VADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISLVTAIAVDRYVAVRHPL RARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSSQTRRNFSTTAFSLLGFY LPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANLAVFVICFLPLHVVLTVQV SLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMAREFQEASKPATSSNTPHKSQD SQILSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tufm sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4989007 1.0 µg DNA

Tufm sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CDK10 Conjugated Antibody
MBS9446144-01 0.1 mL (Biotin)

CDK10 Conjugated Antibody

Sign In for Pricing
View Details
CDK10 Conjugated Antibody
MBS9446144-02 0.1 mL (AF350)

CDK10 Conjugated Antibody

Sign In for Pricing
View Details
CDK10 Conjugated Antibody
MBS9446144-03 0.1 mL (AF405)

CDK10 Conjugated Antibody

Sign In for Pricing
View Details
CDK10 Conjugated Antibody
MBS9446144-04 0.1 mL (AF488)

CDK10 Conjugated Antibody

Sign In for Pricing
View Details
CDK10 Conjugated Antibody
MBS9446144-05 0.1 mL (AF555)

CDK10 Conjugated Antibody

Sign In for Pricing
View Details