Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 35 (Gpr35)

This Recombinant Mouse G-protein coupled receptor 35 (Gpr35) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

G-protein coupled receptor 35, Kynurenic acid receptor, KYNA receptor

UniProt

Q9ES90

Expression Region

1-307

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYRMHQWTETRIYMTNLA VADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISLVTAIAVDRYVAVRHPL RARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSSQTRRNFSTTAFSLLGFY LPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANLAVFVICFLPLHVVLTVQV SLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMAREFQEASKPATSSNTPHKSQD SQILSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sft2d3 (NM_001108887) Rat Tagged ORF Clone Lentiviral Particle
RR208436L3V 200 µL

Sft2d3 (NM_001108887) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Desyl chloride
270926-01 5 g

Desyl chloride

Sign In for Pricing
View Details
Desyl chloride
270926-02 10 g

Desyl chloride

Sign In for Pricing
View Details
Desyl chloride
270926-03 25 g

Desyl chloride

Sign In for Pricing
View Details
Desyl chloride
270926-04 50 g

Desyl chloride

Sign In for Pricing
View Details
Desyl chloride
270926-05 100 g

Desyl chloride

Sign In for Pricing
View Details