Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 12D2 (OR12D2)

This Recombinant Human Olfactory receptor 12D2 (OR12D2) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 12D2, Hs6M1-20, Olfactory receptor OR6-28

UniProt

P58182

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFF LGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHSLGSTESMLFAVMAFDL SVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIK PLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTC ASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVTPVLNPLIYTLRNKEVKGAL GRVIRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ResDetect™ Protein L ELISA Kit
RES-A026-96tests 96 Tests

ResDetect™ Protein L ELISA Kit

Sign In for Pricing
View Details
Influenza A (Nucleoprotein) (MaxLight 750) discontinued discontinued
I7650-84A-ML750 100 µL

Influenza A (Nucleoprotein) (MaxLight 750) discontinued discontinued

Sign In for Pricing
View Details
ADCK2 AAV Vector (Rat) (CMV)
11386106 1 µg

ADCK2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
GNG4 Protein Vector (Mouse) (pPM-C-His)
PV185381 500 ng

GNG4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Pbld2 Mouse siRNA Oligo Duplex (Locus ID 67307)
SR408273 1 Kit

Pbld2 Mouse siRNA Oligo Duplex (Locus ID 67307)

Sign In for Pricing
View Details
RAB4 Recombinant Antibody, FITC Conjugated
bsm-62966R-FITC-TR 20 µL

RAB4 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details