Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AC1 (OR5AC1)

This Recombinant Human Olfactory receptor 5AC1 (OR5AC1) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 5AC1, Olfactory receptor OR3-2

UniProt

P0C628

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEENKILVTHFVLTGLTDHPGLQAPLFLVFLVIYLITLVGNLGLMALIWKDPHLHTPIY LFLGSLAFADACTSSSVTSKMLINFLSKNHMLSMAKCATQFYFFGSNATTECFLLVVMAY DRYVAICNPLLYPVVMSNSLCTQFIGISYFIGFLHSAIHVGLLFRLTFCRSNIIHYFYCE ILQLFKISCTNPTVNILLIFIFSAFIQVFTFMTLIVSYSYILSAILKKKSEKGRSKAFST CSAHLLSVSLFYGTLFFMYVSSRSGSAADQAKMYSLFYTIIIPLLNPFIYSLRNKEVIDA LRRIMKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clavibacter michiganensis subsp. sepedonicus Arginine--tRNA ligase (argS), partial
MBS1096463 Inquire

Recombinant Clavibacter michiganensis subsp. sepedonicus Arginine--tRNA ligase (argS), partial

Sign In for Pricing
View Details
CK1 epsilon (CSNK1E) (NM_152221) Human Over-expression Lysate
LS001454-20ug 20 µg

CK1 epsilon (CSNK1E) (NM_152221) Human Over-expression Lysate

Sign In for Pricing
View Details
N- (2-Fluorophenyl) -2-{[ (2-fluorophenyl) methyl]amino}acetamide hydrochloride
GXB45816-01 100 mg

N- (2-Fluorophenyl) -2-{[ (2-fluorophenyl) methyl]amino}acetamide hydrochloride

Sign In for Pricing
View Details
N- (2-Fluorophenyl) -2-{[ (2-fluorophenyl) methyl]amino}acetamide hydrochloride
GXB45816-02 1 g

N- (2-Fluorophenyl) -2-{[ (2-fluorophenyl) methyl]amino}acetamide hydrochloride

Sign In for Pricing
View Details
RUNDC1, CT (RUNDC1, RUN domain-containing protein 1) (MaxLight 405) discontinued
041331-ML405 100 µL

RUNDC1, CT (RUNDC1, RUN domain-containing protein 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Beta-hexosaminidase subunit A1 (hexa1), partial
MBS1152045 Inquire

Recombinant Dictyostelium discoideum Beta-hexosaminidase subunit A1 (hexa1), partial

Sign In for Pricing
View Details