Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AC1 (OR5AC1)

This Recombinant Human Olfactory receptor 5AC1 (OR5AC1) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 5AC1, Olfactory receptor OR3-2

UniProt

P0C628

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEENKILVTHFVLTGLTDHPGLQAPLFLVFLVIYLITLVGNLGLMALIWKDPHLHTPIY LFLGSLAFADACTSSSVTSKMLINFLSKNHMLSMAKCATQFYFFGSNATTECFLLVVMAY DRYVAICNPLLYPVVMSNSLCTQFIGISYFIGFLHSAIHVGLLFRLTFCRSNIIHYFYCE ILQLFKISCTNPTVNILLIFIFSAFIQVFTFMTLIVSYSYILSAILKKKSEKGRSKAFST CSAHLLSVSLFYGTLFFMYVSSRSGSAADQAKMYSLFYTIIIPLLNPFIYSLRNKEVIDA LRRIMKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Butynoic acid
OR315221-01 5 g

2-Butynoic acid

Sign In for Pricing
View Details
2-Butynoic acid
OR315221-02 25 g

2-Butynoic acid

Sign In for Pricing
View Details
Cis-Verbenol (Standard)
HY-W674037R 1 Each

Cis-Verbenol (Standard)

Sign In for Pricing
View Details
Litifilimab Biosimilar - Research Grade
ICH5648-10mg 10 mg (2x 5 mg)

Litifilimab Biosimilar - Research Grade

Sign In for Pricing
View Details
D-Dimer (Biotin) discontinued
226901-Biotin 100 µL

D-Dimer (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Anti-LIFR Antibody, Rabbit Monoclonal
MBS8103401-01 0.1 mL

Recombinant Anti-LIFR Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details