Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AC1 (OR5AC1)

This Recombinant Human Olfactory receptor 5AC1 (OR5AC1) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 5AC1, Olfactory receptor OR3-2

UniProt

P0C628

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEENKILVTHFVLTGLTDHPGLQAPLFLVFLVIYLITLVGNLGLMALIWKDPHLHTPIY LFLGSLAFADACTSSSVTSKMLINFLSKNHMLSMAKCATQFYFFGSNATTECFLLVVMAY DRYVAICNPLLYPVVMSNSLCTQFIGISYFIGFLHSAIHVGLLFRLTFCRSNIIHYFYCE ILQLFKISCTNPTVNILLIFIFSAFIQVFTFMTLIVSYSYILSAILKKKSEKGRSKAFST CSAHLLSVSLFYGTLFFMYVSSRSGSAADQAKMYSLFYTIIIPLLNPFIYSLRNKEVIDA LRRIMKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Apolipoprotein A1 (APOA1) ELISA Kit
DLR-APOA1-Si-01 48 Tests

Monkey Apolipoprotein A1 (APOA1) ELISA Kit

Sign In for Pricing
View Details
Monkey Apolipoprotein A1 (APOA1) ELISA Kit
DLR-APOA1-Si-02 96 Tests

Monkey Apolipoprotein A1 (APOA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Rabbit Tumor Necrosis Factor Alpha (TNFa) Monoclonal Antibody
VD4N196 1 Each

Mouse Anti-Rabbit Tumor Necrosis Factor Alpha (TNFa) Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal LIFR alpha Antibody (32953) [DyLight 755]
FAB249Z 0.5 mL

Mouse Monoclonal LIFR alpha Antibody (32953) [DyLight 755]

Sign In for Pricing
View Details
(S) -N-Methyl pregabalin-d5
HY-W700565-01 1 mg

(S) -N-Methyl pregabalin-d5

Sign In for Pricing
View Details
(S) -N-Methyl pregabalin-d5
HY-W700565-02 10 mg

(S) -N-Methyl pregabalin-d5

Sign In for Pricing
View Details