Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class V-1 (srv-1)

This Recombinant Serpentine receptor class V-1 (srv-1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Serpentine receptor class V-1, Protein srv-1, Protein srg-12

UniProt

P46564

Expression Region

1-308

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAFLDVAITIEYVSTAISLVCLPINILFVYILFVERNRPPYNTPFFRLCIHLSIADIL MELFSTFFFKFPSFGVFPSTFYKENWSVVPIAGMQYLGHAQAFGIIFIAVNRFTAVHYPI KHRQQWWTPKVTKTLLLIQWITPLFFMAPLFSTDFKFLFSHNSGSVIFAASDARFHKNYF LAMAMVDGILINLIVLLLYGAIFIRVHTHVVVRKPGELALRLALSAFIIFICYLALGVCS LLSALTPPPDAWVYRTMWFVVNDVLCNSSALVLLALNRPIRKAFTRHLGVFSYQGVSTKN HNSLLQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Endometrium
CB526701 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
ACTG2 Rabbit Polyclonal Antibody
AP06002PU-N 100 µg

ACTG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Diethylaminoethyl Hexanoate Citrate Salt
TRC-D443908-50MG 50 mg

2-Diethylaminoethyl Hexanoate Citrate Salt

Sign In for Pricing
View Details
Mouse Ddx3x activation kit by CRISPRa
GA201046 1 Kit

Mouse Ddx3x activation kit by CRISPRa

Sign In for Pricing
View Details
PDCD6 Recombinant Mouse Monoclonal Antibody [A6A7-R]
HA601219 100 µL

PDCD6 Recombinant Mouse Monoclonal Antibody [A6A7-R]

Sign In for Pricing
View Details
MIR6869 Human qPCR Primer Pair (MI0022716)
HP301472 200 Reactions

MIR6869 Human qPCR Primer Pair (MI0022716)

Sign In for Pricing
View Details