Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class V-1 (srv-1)

This Recombinant Serpentine receptor class V-1 (srv-1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Serpentine receptor class V-1, Protein srv-1, Protein srg-12

UniProt

P46564

Expression Region

1-308

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAFLDVAITIEYVSTAISLVCLPINILFVYILFVERNRPPYNTPFFRLCIHLSIADIL MELFSTFFFKFPSFGVFPSTFYKENWSVVPIAGMQYLGHAQAFGIIFIAVNRFTAVHYPI KHRQQWWTPKVTKTLLLIQWITPLFFMAPLFSTDFKFLFSHNSGSVIFAASDARFHKNYF LAMAMVDGILINLIVLLLYGAIFIRVHTHVVVRKPGELALRLALSAFIIFICYLALGVCS LLSALTPPPDAWVYRTMWFVVNDVLCNSSALVLLALNRPIRKAFTRHLGVFSYQGVSTKN HNSLLQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF555 conjugate, 0.1mg/mL
BNC552748-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASB11 (NM_001012428) Human Over-expression Lysate
LC422864 20 µg

ASB11 (NM_001012428) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Phospholipase c eta 1 (PLCH1) activation kit by CRISPRa
GA107964 1 Kit

Human Phospholipase c eta 1 (PLCH1) activation kit by CRISPRa

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF799 activation kit by CRISPRa
GA114036 1 Kit

Human ZNF799 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD45.1 Antibody[A20]
E-AB-F1184UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD45.1 Antibody[A20]

Sign In for Pricing
View Details