Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA)

This Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsA

UniProt

A7M9A9

Expression Region

1-308

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVSTLEHILTHISLSIVSILITIELRIFLDDEIKKLYDSSERGMLITFLCITGLLANNW IYLGHFPLSDLSESLIFLSWSFALIHSIGYFTKNLKFLSTITSQSTLFTQGFATSGILTK IQKSSILIPALKSEWLIMHVSLMILGYAALLCGSLLSVALMVITVRNDGKFFFKSNNFLF REISYQNKNFFYAINYYKTQLIKELDFWSYQVISLGFIFLTIGILSGAVWANEAWGSYWS WDPKETWAFITWIVFAIYLHTRININLQSTNSAIVASLGFIIIWICYFGVNLVGLGLHSY GSFPSTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCN2 (C-term) Rabbit Polyclonal Antibody
AP14569PU-N 400 µL

CCN2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRI1 (NM_001031727) Human Over-expression Lysate
LY422176 100 µg

MRI1 (NM_001031727) Human Over-expression Lysate

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF488A conjugate, 0.1mg/mL
BNC881826-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF45 (NM_003425) Human Over-expression Lysate
LC401162 20 µg

ZNF45 (NM_003425) Human Over-expression Lysate

Sign In for Pricing
View Details
ZIP12 Rabbit Polyclonal Antibody
ER1706-33 100 µL

ZIP12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ArylsULfatase D (ARSD) activation kit by CRISPRa
GA100302 1 Kit

Human ArylsULfatase D (ARSD) activation kit by CRISPRa

Sign In for Pricing
View Details