Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA)

This Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsA

UniProt

A7M9A9

Expression Region

1-308

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVSTLEHILTHISLSIVSILITIELRIFLDDEIKKLYDSSERGMLITFLCITGLLANNW IYLGHFPLSDLSESLIFLSWSFALIHSIGYFTKNLKFLSTITSQSTLFTQGFATSGILTK IQKSSILIPALKSEWLIMHVSLMILGYAALLCGSLLSVALMVITVRNDGKFFFKSNNFLF REISYQNKNFFYAINYYKTQLIKELDFWSYQVISLGFIFLTIGILSGAVWANEAWGSYWS WDPKETWAFITWIVFAIYLHTRININLQSTNSAIVASLGFIIIWICYFGVNLVGLGLHSY GSFPSTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTF1 (MTF1/2649), CF740 conjugate, 0.1mg/mL
BNC742649-100 1x 100 µL

MTF1 (MTF1/2649), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smad4 Mouse Gene Knockout Kit (CRISPR)
KN316273RB 1 Kit

Smad4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD79A Mouse Monoclonal Antibody [Clone ID: SPM549]
AM50196PU-T 20 µg

CD79A Mouse Monoclonal Antibody [Clone ID: SPM549]

Sign In for Pricing
View Details
LYPD1 Human Gene Knockout Kit (CRISPR)
KN205703RB 1 Kit

LYPD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), Biotin conjugate, 0.1mg/mL
BNCB3776-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human PF4 (Platelet Factor 4) ELISA Kit
E-UNEL-H0162-01 5x 96 Tests

Uncoated Human PF4 (Platelet Factor 4) ELISA Kit

Sign In for Pricing
View Details