Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA)

This Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsA

UniProt

A7M9A9

Expression Region

1-308

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVSTLEHILTHISLSIVSILITIELRIFLDDEIKKLYDSSERGMLITFLCITGLLANNW IYLGHFPLSDLSESLIFLSWSFALIHSIGYFTKNLKFLSTITSQSTLFTQGFATSGILTK IQKSSILIPALKSEWLIMHVSLMILGYAALLCGSLLSVALMVITVRNDGKFFFKSNNFLF REISYQNKNFFYAINYYKTQLIKELDFWSYQVISLGFIFLTIGILSGAVWANEAWGSYWS WDPKETWAFITWIVFAIYLHTRININLQSTNSAIVASLGFIIIWICYFGVNLVGLGLHSY GSFPSTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA2 (NM_002787) Human Over-expression Lysate
LY419115 100 µg

PSMA2 (NM_002787) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyanine 750 Succinimidyl Ester
#90049-1mg 1x 1 mg

Cyanine 750 Succinimidyl Ester

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) S1 protein (HV69-70del), His Tag
S1N-C52Hd-100ug 100 µg

SARS-CoV-2 (COVID-19) S1 protein (HV69-70del), His Tag

Sign In for Pricing
View Details
FUT3 (NM_000149) Human Over-expression Lysate
LY424899 100 µg

FUT3 (NM_000149) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LGICZ1 (ZACN) activation kit by CRISPRa
GA117722 1 Kit

Human LGICZ1 (ZACN) activation kit by CRISPRa

Sign In for Pricing
View Details
PPAP2C (PLPP2) Rabbit Polyclonal Antibody
AP05175PU-N 100 µg

PPAP2C (PLPP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details