Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gamma-secretase subunit aph-1 (aph-1)

This Recombinant Gamma-secretase subunit aph-1 (aph-1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Gamma-secretase subunit aph-1, Anterior-pharynx-defective protein 1, Presenilin enhancer protein 1

UniProt

O45876

Expression Region

1-308

Origin

Caenorhabditis elegans

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGYLLTIACYIASFSPSIALFCSFIAHDPVRIILFFLGSFFWLVSLLFSSLAWLGLSTVL PDTFLLSLTVCIIAQELSRVAYFMLLKKAQRGLNKITRQGQISVAPGVSDLHNARHMLAL VCGLGMGVISALFYTMNAFAIFSGPGTIGLPNALKTGEIDTNRAGKYLPLCYTLSAILLT LFHVTWTIMVWDSCHKIGRIPSAFVPGAAAVVSHLLVTFLSSLNSRGFHVLVFAVQFLIL LICIAYCNVIMGGTISSFVNGIGQSITDAVTLKQVRTLIEERKLRTQRQSVPDEPMTERA GTSNTVNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag)
PKSR030500 100 µg

Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag)

Sign In for Pricing
View Details
CTAGE4 Human Gene Knockout Kit (CRISPR)
KN426160 1 Kit

CTAGE4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NRXN3 Rabbit Polyclonal Antibody
TA379323 100 µL

NRXN3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MATN2 Antibody
KC-734-01 50 μL

MATN2 Antibody

Sign In for Pricing
View Details
MATN2 Antibody
KC-734-02 100 µL

MATN2 Antibody

Sign In for Pricing
View Details
MATN2 Antibody
KC-734-03 1 mL

MATN2 Antibody

Sign In for Pricing
View Details