Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gamma-secretase subunit aph-1 (aph-1)

This Recombinant Gamma-secretase subunit aph-1 (aph-1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Gamma-secretase subunit aph-1, Anterior-pharynx-defective protein 1, Presenilin enhancer protein 1

UniProt

O45876

Expression Region

1-308

Origin

Caenorhabditis elegans

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGYLLTIACYIASFSPSIALFCSFIAHDPVRIILFFLGSFFWLVSLLFSSLAWLGLSTVL PDTFLLSLTVCIIAQELSRVAYFMLLKKAQRGLNKITRQGQISVAPGVSDLHNARHMLAL VCGLGMGVISALFYTMNAFAIFSGPGTIGLPNALKTGEIDTNRAGKYLPLCYTLSAILLT LFHVTWTIMVWDSCHKIGRIPSAFVPGAAAVVSHLLVTFLSSLNSRGFHVLVFAVQFLIL LICIAYCNVIMGGTISSFVNGIGQSITDAVTLKQVRTLIEERKLRTQRQSVPDEPMTERA GTSNTVNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fatty Acid-Binding Protein 3 (FABP3) AssayLite™ Antibody (APC Conjugate)
31132-05161 5x 30 µg

Human Fatty Acid-Binding Protein 3 (FABP3) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
Phospho-CDK1/2 (Thr14) (5Z8) Rabbit Monoclonal Antibody
E28M0375 100 µL

Phospho-CDK1/2 (Thr14) (5Z8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
API5 Rabbit Polyclonal Antibody (BF405)
orb2533548 100 µL

API5 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
CHRNB1 Antibody
ABD3724 100 µg

CHRNB1 Antibody

Sign In for Pricing
View Details
Csn1s1 siRNA Oligos set (Mouse)
16931174 3x 5 nmol

Csn1s1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Vespa orientalis Chymotrypsin-2
MBS1231428-01 0.02 mg (E-Coli)

Recombinant Vespa orientalis Chymotrypsin-2

Sign In for Pricing
View Details