Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YOL092W (YOL092W)

This Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YOL092W (YOL092W) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein YOL092W

UniProt

Q12010

Expression Region

1-308

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLVPLELNRSTLSGISGSISISCWIIVFVPQIYENFYRKSSDGLSLLFVVLWLAGDVFN LMGAVMQHLLSTMIILAAYYTVADIILLGQCLWYDNEEKPAVDPIHLSPANPINENVLHD VFNEQQPLLNSQGQPNRIDEEMAAPSSDGNAGDDNLREVNSRNLIKDIFIVSGVVFVGFI SWYVTYCVNYTQPPPVEDPSLPVPELQINWMAQIFGYLSALLYLGSRIPQILLNFKRKSC EGISFLFFLFACLGNTTFIFSVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYK RNKKFILN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-500 1x 500 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL
BNC681931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL
BNC680413-500 1x 500 µL

Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details