Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0880 (MJ0880)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0880 (MJ0880) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0880

UniProt

Q58290

Expression Region

1-308

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDILPYLTKIILLSSIGITIASIIVETNLISKIKKITKPICLISNLPEECVVSLLGNFIN PTVGKSMLSGFYKENKVNEKEVIVTTIISPLPTILGESVFRVQLPLAVVILGYKLGLIYV SLNVISGFLQALIGILYANIFFERRQINIDNNNNEKIVFNREVIIKGFKKSLKILKKVIP MIVIFTLLINFLIKLGLMDVVKGLFSPIFRILDLPGEAITVLIANLAHFSAGYTTVDILI KNGVLNEKQALIVLLIGNIISVTMIYLKHSIGTYISLFGRFGLKLAVINYTISVMIKILL ILLLIAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant cIAP2 Antibody
RC-16970-01 50 μL

Recombinant cIAP2 Antibody

Sign In for Pricing
View Details
Recombinant cIAP2 Antibody
RC-16970-02 100 µL

Recombinant cIAP2 Antibody

Sign In for Pricing
View Details
Recombinant cIAP2 Antibody
RC-16970-03 1 mL

Recombinant cIAP2 Antibody

Sign In for Pricing
View Details
SYPL2 (NM_001040709) Human Over-expression Lysate
LY420833 100 µg

SYPL2 (NM_001040709) Human Over-expression Lysate

Sign In for Pricing
View Details
IL-4 (Interleukin-4), Mouse (11B11), CF740 conjugate, 0.1mg/mL
BNC742008-100 1x 100 µL

IL-4 (Interleukin-4), Mouse (11B11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), 0.2mg/mL
BNUB3076-100 1x 100 µL

APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), 0.2mg/mL

Sign In for Pricing
View Details