Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0880 (MJ0880)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0880 (MJ0880) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0880

UniProt

Q58290

Expression Region

1-308

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDILPYLTKIILLSSIGITIASIIVETNLISKIKKITKPICLISNLPEECVVSLLGNFIN PTVGKSMLSGFYKENKVNEKEVIVTTIISPLPTILGESVFRVQLPLAVVILGYKLGLIYV SLNVISGFLQALIGILYANIFFERRQINIDNNNNEKIVFNREVIIKGFKKSLKILKKVIP MIVIFTLLINFLIKLGLMDVVKGLFSPIFRILDLPGEAITVLIANLAHFSAGYTTVDILI KNGVLNEKQALIVLLIGNIISVTMIYLKHSIGTYISLFGRFGLKLAVINYTISVMIKILL ILLLIAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3f3b (BC092300) Mouse Tagged ORF Clone
MG200859 10 µg

H3f3b (BC092300) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF647 conjugate, 0.1mg/mL
BNC472540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Chlorobenzoic anhydride
TRC-C427630-500MG 500 mg

4-Chlorobenzoic anhydride

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR559586 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1/BGP-1 protein (His Tag)
PDEM100234-01 20 µg

Recombinant Mouse Ceacam1/BGP-1 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1/BGP-1 protein (His Tag)
PDEM100234-02 100 µg

Recombinant Mouse Ceacam1/BGP-1 protein (His Tag)

Sign In for Pricing
View Details