Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Taste receptor type 2 member 10 (TAS2R10)

This Recombinant Pongo pygmaeus Taste receptor type 2 member 10 (TAS2R10) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 10, T2R10

UniProt

Q645V0

Expression Region

1-308

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSVVEGIFIFVVISESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWV IITDGFIQIFSPDIYASGNLIEYISYIWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW LKSRTNMVLPFMMAFLLISSLLNFAHIVKILNDHKMKNDTVWHLNMYKSEYFIKQILLNL GVIFFFTLSLITCVLLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF IGMALEISRFTVPENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK RKKSQSHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details