Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba Cytochrome c biogenesis protein ccsA (ccsA)

This Recombinant Nymphaea alba Cytochrome c biogenesis protein ccsA (ccsA) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsA

UniProt

Q6EW01

Expression Region

1-308

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIFATLEHILTHISFSIISIVIPTHLMTLVYEIVGLCDSSEKGMITTFFCITGLLVTRWI YSGHVPLSDLYESLMFLSWSFSLIHIVPYFRNYKNFFSKITAPSAILTQGFATSGLLTKM HQSAILVPALQSRWLMMHVSMMLLSYAALLCGSLLSITLLVITFRRKIDIFGKTNHLLIS SFSFDETQYVNFSFRNYHRYQLTQRLDYWSYRVIGLGFTLLTIGILSGAVWANEAWGSYW NWDPKETWAFITWTVFAIYLHTRTNKSLQGANSAIVASMGFLIIWICYFGVNLLGRGLHS YGSFTLNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
BNC940012-500 1x 500 µL

Tyrosinase (T311), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF405S conjugate, 0.1mg/mL
BNC041970-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF405S conjugate, 0.1mg/mL
BNC042340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF647 conjugate, 0.1mg/mL
BNC470907-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-500 1x 500 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details