Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4N5 (OR4N5)

This Recombinant Human Olfactory receptor 4N5 (OR4N5) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 4N5, Olfactory receptor OR14-33

UniProt

Q8IXE1

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METQNLTVVTEFILLGLTQSQDAQLLVFVLVLIFYLIILPGNFLIIFTIKSDPGLTAPLY FFLGNLALLDASYSFIVVPRMLVDFLSEKKVISYRSCITQLFFLHFLGAGEMFLLVVMAF DRYIAICRPLHYSTIMNPRACYALSLVLWLGGFIHSIVQVALILHLPFCGPNQLDNFFCD VPQVIKLACTNTFVVELLMVSNSGLLSLLCFLGLLASYAVILCRIREHSSEGKSKAISTC TTHIIIIFLMFGPAIFIYTCPFQAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRK LLSQHMFC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVOL2 Polyclonal Antibody
E-AB-18813-01 20 µL

OVOL2 Polyclonal Antibody

Sign In for Pricing
View Details
OVOL2 Polyclonal Antibody
E-AB-18813-02 60 µL

OVOL2 Polyclonal Antibody

Sign In for Pricing
View Details
OVOL2 Polyclonal Antibody
E-AB-18813-03 120 µL

OVOL2 Polyclonal Antibody

Sign In for Pricing
View Details
OVOL2 Polyclonal Antibody
E-AB-18813-04 200 µL

OVOL2 Polyclonal Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-8479-01 50 μL

MNDA Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-8479-02 100 µL

MNDA Antibody

Sign In for Pricing
View Details