Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6F1 (OR6F1)

This Recombinant Human Olfactory receptor 6F1 (OR6F1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 6F1, Olfactory receptor OR1-38

UniProt

Q8NGZ6

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTGNKTLPQDFLLLGFPGSQTLQLSLFMLFLVMYILTVSGNVAILMLVSTSHQLHTPMY FFLSNLSFLEIWYTTAAVPKALAILLGRSQTISFTSCLLQMYFVFSLGCTEYFLLAAMAY DRCLAICYPLHYGAIMSSLLSAQLALGSWVCGFVAIAVPTALISGLSFCGPRAINHFFCD IAPWIALACTNTQAVELVAFVIAVVVILSSCLITFVSYVYIISTILRIPSASGRSKAFST CSSHLTVVLIWYGSTVFLHVRTSIKDALDLIKAVHVLNTVVTPVLNPFIYTLRNKEVRET LLKKWKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Infliximab Antibody (23H5), mAb, Mouse
A02041-40 40 µg

Anti-Infliximab Antibody (23H5), mAb, Mouse

Sign In for Pricing
View Details
Lentiviral mouse Mageb3 shRNA (UAS) - Lentiviral mouse Mageb3 shRNA (UAS, iRFP) plasmid
GTR15148156 1 Vial

Lentiviral mouse Mageb3 shRNA (UAS) - Lentiviral mouse Mageb3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
FAM160A2 shRNA Plasmid (m)
sc-108950-SH 20 µg

FAM160A2 shRNA Plasmid (m)

Sign In for Pricing
View Details
PUS7 Protein Vector (Mouse) (pPM-C-HA)
PV221224 500 ng

PUS7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal TTYH1 Antibody [Alexa Fluor 405]
NBP2-81944AF405 0.1 mL

Rabbit Polyclonal TTYH1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Mouse BDNF/NT-3 growth factors receptor (Ntrk2)
MBS959594 Inquire

Recombinant Mouse BDNF/NT-3 growth factors receptor (Ntrk2)

Sign In for Pricing
View Details