Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6F1 (OR6F1)

This Recombinant Human Olfactory receptor 6F1 (OR6F1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 6F1, Olfactory receptor OR1-38

UniProt

Q8NGZ6

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTGNKTLPQDFLLLGFPGSQTLQLSLFMLFLVMYILTVSGNVAILMLVSTSHQLHTPMY FFLSNLSFLEIWYTTAAVPKALAILLGRSQTISFTSCLLQMYFVFSLGCTEYFLLAAMAY DRCLAICYPLHYGAIMSSLLSAQLALGSWVCGFVAIAVPTALISGLSFCGPRAINHFFCD IAPWIALACTNTQAVELVAFVIAVVVILSSCLITFVSYVYIISTILRIPSASGRSKAFST CSSHLTVVLIWYGSTVFLHVRTSIKDALDLIKAVHVLNTVVTPVLNPFIYTLRNKEVRET LLKKWKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actinomycin X2
orb1691404 25 mg

Actinomycin X2

Sign In for Pricing
View Details
Mouse Monoclonal Myosin Light Chain 2 Antibody (3B2) [Alexa Fluor 750]
NBP1-30249AF750 0.1 mL

Mouse Monoclonal Myosin Light Chain 2 Antibody (3B2) [Alexa Fluor 750]

Sign In for Pricing
View Details
BM-15x75-7643-YL Pre-sized Tags for Printers
312176 250 Roll (250 Label x 1 Roll)

BM-15x75-7643-YL Pre-sized Tags for Printers

Sign In for Pricing
View Details
Sitravatinib (MGCD516)
C13508-5mg 5 mg

Sitravatinib (MGCD516)

Sign In for Pricing
View Details
SOD2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1607272 100 µL

SOD2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
ZACN Recombinant Protein (Human)
RP044908 100 µg

ZACN Recombinant Protein (Human)

Sign In for Pricing
View Details