Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8D1 (OR8D1)

This Recombinant Human Olfactory receptor 8D1 (OR8D1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 8D1, OST004, Olfactory receptor 8D3, Olfactory receptor OR11-301, Olfactory receptor-like protein JCG9

UniProt

Q8WZ84

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMY YFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAY DRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCD VLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGT CSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA LRKVLVGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRSF6 Human Gene Knockout Kit (CRISPR)
KN401541 1 Kit

SRSF6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mixture of 10,11-Dibromo-10,11-dihydro-5H-dibenz[b,f]azepine-5-carbonyl chloride & 10,11-Dibromo-10,11-dihydro-5H-dibenz[b,f]azepine-5-carbonyl Bromide
TRC-D418790-100MG 100 mg

Mixture of 10,11-Dibromo-10,11-dihydro-5H-dibenz[b,f]azepine-5-carbonyl chloride & 10,11-Dibromo-10,11-dihydro-5H-dibenz[b,f]azepine-5-carbonyl Bromide

Sign In for Pricing
View Details
RAE1 (NM_001015885) Human Over-expression Lysate
LY423133 100 µg

RAE1 (NM_001015885) Human Over-expression Lysate

Sign In for Pricing
View Details
ZXDB Human Gene Knockout Kit (CRISPR)
KN419534 1 Kit

ZXDB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Azetirelin (~85%)
TRC-A817605-5MG 5 mg

Azetirelin (~85%)

Sign In for Pricing
View Details
SLFN14 Human Gene Knockout Kit (CRISPR)
KN426257 1 Kit

SLFN14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details