Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52E1 (OR52E1)

This Recombinant Human Olfactory receptor 52E1 (OR52E1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 52E1

UniProt

Q8NGJ3

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTTLFHPYSFLLLGIPGLESMHLWVGFPFFAVFLTAVLGNITILFVIQTDSSLHHPMFY FLAILSSIDPGLSTSTIPKMLGTFWFTLREISFEGCLTQMFFIHLCTGMESAVLVAMAYD CYVAICDPLCYTLVLTNKVVSVMALAIFLRPLVFVIPFVLFILRLPFCGHQIIPHTYGEH MGIARLSCASIRVNIIYGLCAISILVFDIIAIVISYVQILCAVFLLSSHDARLKAFSTCG SHVCVMLTFYMPAFFSFMTHRFGRNIPHFIHILLANFYVVIPPALNSVIYGVRTKQIRAQ VLKMFFNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coelenterazine F
#10114-2 1x 250 µg

Coelenterazine F

Sign In for Pricing
View Details
KANSL1 Polyclonal Antibody
E-AB-90242-01 60 µL

KANSL1 Polyclonal Antibody

Sign In for Pricing
View Details
KANSL1 Polyclonal Antibody
E-AB-90242-02 120 µL

KANSL1 Polyclonal Antibody

Sign In for Pricing
View Details
KANSL1 Polyclonal Antibody
E-AB-90242-03 200 µL

KANSL1 Polyclonal Antibody

Sign In for Pricing
View Details
TULp3 Mouse Gene Knockout Kit (CRISPR)
KN518487 1 Kit

TULp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATPBD4 (DPH6) Human Gene Knockout Kit (CRISPR)
KN209471LP 1 Kit

ATPBD4 (DPH6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details