Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52E1 (OR52E1)

This Recombinant Human Olfactory receptor 52E1 (OR52E1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 52E1

UniProt

Q8NGJ3

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTTLFHPYSFLLLGIPGLESMHLWVGFPFFAVFLTAVLGNITILFVIQTDSSLHHPMFY FLAILSSIDPGLSTSTIPKMLGTFWFTLREISFEGCLTQMFFIHLCTGMESAVLVAMAYD CYVAICDPLCYTLVLTNKVVSVMALAIFLRPLVFVIPFVLFILRLPFCGHQIIPHTYGEH MGIARLSCASIRVNIIYGLCAISILVFDIIAIVISYVQILCAVFLLSSHDARLKAFSTCG SHVCVMLTFYMPAFFSFMTHRFGRNIPHFIHILLANFYVVIPPALNSVIYGVRTKQIRAQ VLKMFFNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD86 Protein (His Tag)
PDMR100053-01 20 µg

Recombinant Rat CD86 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat CD86 Protein (His Tag)
PDMR100053-02 100 µg

Recombinant Rat CD86 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat CD86 Protein (His Tag)
PDMR100053-03 500 µg

Recombinant Rat CD86 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat CD86 Protein (His Tag)
PDMR100053-04 1 mg

Recombinant Rat CD86 Protein (His Tag)

Sign In for Pricing
View Details
TGF beta 1 (TGFB1) (N-term) Rabbit Polyclonal Antibody
AP54230PU-N 400 µL

TGF beta 1 (TGFB1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIB3 Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF807540 100 µg

TRIB3 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details