Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52E1 (OR52E1)

This Recombinant Human Olfactory receptor 52E1 (OR52E1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 52E1

UniProt

Q8NGJ3

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTTLFHPYSFLLLGIPGLESMHLWVGFPFFAVFLTAVLGNITILFVIQTDSSLHHPMFY FLAILSSIDPGLSTSTIPKMLGTFWFTLREISFEGCLTQMFFIHLCTGMESAVLVAMAYD CYVAICDPLCYTLVLTNKVVSVMALAIFLRPLVFVIPFVLFILRLPFCGHQIIPHTYGEH MGIARLSCASIRVNIIYGLCAISILVFDIIAIVISYVQILCAVFLLSSHDARLKAFSTCG SHVCVMLTFYMPAFFSFMTHRFGRNIPHFIHILLANFYVVIPPALNSVIYGVRTKQIRAQ VLKMFFNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human IL-16 (Interleukin 16) ELISA Kit
E-UNEL-H0261-01 5x 96 Tests

Uncoated Human IL-16 (Interleukin 16) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human IL-16 (Interleukin 16) ELISA Kit
E-UNEL-H0261-02 15x 96 Tests

Uncoated Human IL-16 (Interleukin 16) ELISA Kit

Sign In for Pricing
View Details
PRPSAP1 (NM_002766) Human Over-expression Lysate
LY432208 100 µg

PRPSAP1 (NM_002766) Human Over-expression Lysate

Sign In for Pricing
View Details
RNF149 Rabbit Polyclonal Antibody
TA380979 100 µL

RNF149 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Penciclovir Diacetate
TRC-P221505-50MG 50 mg

Penciclovir Diacetate

Sign In for Pricing
View Details
Human WDR35 activation kit by CRISPRa
GA111572 1 Kit

Human WDR35 activation kit by CRISPRa

Sign In for Pricing
View Details