Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 187 (Olfr187)

This Recombinant Mouse Olfactory receptor 187 (Olfr187) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 187, Olfactory receptor 183-8

UniProt

Q8VEX6

Expression Region

1-308

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKNATLLTEFVLTGLSHQPLWNIPLFLVFLVIYLITIVGNVSLITLIWTDPHLHIPMYL FLGSLAFVDTSISSIVVPKMLLNFFGKSKVITLSECMAQFFLFNISATTECFLLAAMAYD RYVAICKPLLYPVVMTNGLCVWLIALSFVAGIIHALIHEGFLLRLTFCNSNMIHNFYCDI ISLLKISCTDTSLNYLIVFIFSGSIQVFTISTILVSYTIILFTILKKKSAKGIKKAFSTC GAHLLSVSLYYGPLLFMYVHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSL AKFLKRNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.),
BAF-444-1 1 mL

Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.),

Sign In for Pricing
View Details
Tissue Genomic DNA, Prostate
CD565011 5 µg

Tissue Genomic DNA, Prostate

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: left
CP565787 150 µg

Tissue Protein Lysate, Ovary: left

Sign In for Pricing
View Details
Finerenone-D5
TRC-F436791-1MG 1 mg

Finerenone-D5

Sign In for Pricing
View Details
Human EIF3K activation kit by CRISPRa
GA109128 1 Kit

Human EIF3K activation kit by CRISPRa

Sign In for Pricing
View Details
DUOX1 Human Gene Knockout Kit (CRISPR)
KN223832BN 1 Kit

DUOX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details