Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2D2 (OR2D2)

This Recombinant Human Olfactory receptor 2D2 (OR2D2) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 2D2, HB2, Olfactory receptor 11-610, OR11-610, Olfactory receptor 2D1, Olfactory receptor OR11-88

UniProt

Q9H210

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMY FFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVMSY DRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFILRLPYRGSNSIAHFFCE APALLILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFST CGSHLMVVILFYGSAIITYMTPKSSKQQEKSVSVFYAIVTPMLNPLIYSLRNKDVKAALR KVATRNFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARN Human Over-expression Lysate
orb1365417 20 µg

PARN Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-P311 antibody
STJ94874 200 µl

Anti-P311 antibody

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)
MBS1183876-01 0.02 mg (E-Coli)

Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)
MBS1183876-02 0.1 mg (E-Coli)

Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)
MBS1183876-03 0.02 mg (Yeast)

Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)
MBS1183876-04 0.1 mg (Yeast)

Recombinant Aeromonas hydrophila subsp. hydrophila Co-chaperone protein hscB homolog (hscB)

Sign In for Pricing
View Details