Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2D2 (OR2D2)

This Recombinant Human Olfactory receptor 2D2 (OR2D2) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 2D2, HB2, Olfactory receptor 11-610, OR11-610, Olfactory receptor 2D1, Olfactory receptor OR11-88

UniProt

Q9H210

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMY FFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVMSY DRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFILRLPYRGSNSIAHFFCE APALLILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFST CGSHLMVVILFYGSAIITYMTPKSSKQQEKSVSVFYAIVTPMLNPLIYSLRNKDVKAALR KVATRNFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPY30 (NM_032574) Human Recombinant Protein
PROTQ9C005 20 µg

DPY30 (NM_032574) Human Recombinant Protein

Sign In for Pricing
View Details
CK II alpha Polyclonal Antibody, Cy7 Conjugated
bs-1607R-Cy7 100 µL

CK II alpha Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Enterovirus A71 Genome polyprotein, partial
MBS7136977-01 0.02 mg (E-Coli)

Recombinant Enterovirus A71 Genome polyprotein, partial

Sign In for Pricing
View Details
Recombinant Enterovirus A71 Genome polyprotein, partial
MBS7136977-02 0.1 mg (E-Coli)

Recombinant Enterovirus A71 Genome polyprotein, partial

Sign In for Pricing
View Details
Recombinant Enterovirus A71 Genome polyprotein, partial
MBS7136977-03 1 mg (E-Coli)

Recombinant Enterovirus A71 Genome polyprotein, partial

Sign In for Pricing
View Details
Recombinant Enterovirus A71 Genome polyprotein, partial
MBS7136977-04 5x 1 mg (E-Coli)

Recombinant Enterovirus A71 Genome polyprotein, partial

Sign In for Pricing
View Details