Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T7 (OR2T7)

This Recombinant Human Olfactory receptor 2T7 (OR2T7) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 2T7, OST723, olfactory receptor OR1-44

UniProt

P0C7T2

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLSFWVCSATPVSPGFFALILLVFVTSIASNVVKIILIHIDSRLHTPMYFLLSQLSLR DILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSCDRYVAICNP LHYPDLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCEVPALLKLSC TDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRRKAVATCSSHMVVVS LFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGALQKVVGRCV SSGKVTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D4 Adenovirus (Rat)
48963056 1.0 mL

UBE2D4 Adenovirus (Rat)

Sign In for Pricing
View Details
IκB β Monoclonal Antibody (1F3)
E044103 100 µg -100 µL

IκB β Monoclonal Antibody (1F3)

Sign In for Pricing
View Details
Mouse Lypd9 activation kit by CRISPRa
GA217380 1 Kit

Mouse Lypd9 activation kit by CRISPRa

Sign In for Pricing
View Details
Lentiviral human PIK3CB shRNA (UAS) - Lentiviral human PIK3CB shRNA (UAS) (25)
GTR15127109 1 Vial

Lentiviral human PIK3CB shRNA (UAS) - Lentiviral human PIK3CB shRNA (UAS) (25)

Sign In for Pricing
View Details
Sheep Inhibitors of Nitric Oxide Synthases ELISA Kit
GTR10338435 96 Well

Sheep Inhibitors of Nitric Oxide Synthases ELISA Kit

Sign In for Pricing
View Details
TRRAP ORF Vector (Human) (pORF)
ORF035175 1.0 µg DNA

TRRAP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details