Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T7 (OR2T7)

This Recombinant Human Olfactory receptor 2T7 (OR2T7) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 2T7, OST723, olfactory receptor OR1-44

UniProt

P0C7T2

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLSFWVCSATPVSPGFFALILLVFVTSIASNVVKIILIHIDSRLHTPMYFLLSQLSLR DILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSCDRYVAICNP LHYPDLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCEVPALLKLSC TDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRRKAVATCSSHMVVVS LFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGALQKVVGRCV SSGKVTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RFXANK (NM_001278728) AAV Particle
RC236810A1V 250 µL

Human RFXANK (NM_001278728) AAV Particle

Sign In for Pricing
View Details
Anti-Phospho-Rb (Ser807) Rabbit Monoclonal Antibody
MA4519-.05 50 µL

Anti-Phospho-Rb (Ser807) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PHF22 (INTS12) (NM_020395) Human Over-expression Lysate
E45H11147-2 20 µg

PHF22 (INTS12) (NM_020395) Human Over-expression Lysate

Sign In for Pricing
View Details
Vamp5 Rat siRNA Oligo Duplex (Locus ID 89818)
SR505256 1 Kit

Vamp5 Rat siRNA Oligo Duplex (Locus ID 89818)

Sign In for Pricing
View Details
KLRAQ1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
25870064 1.0 µg DNA

KLRAQ1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Tadocizumab (ITGA2B_ITGB3) - Research Grade Biosimilar
10-130 0.1 mg

Tadocizumab (ITGA2B_ITGB3) - Research Grade Biosimilar

Sign In for Pricing
View Details