Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein HVLF2 (US16)

This Recombinant Human cytomegalovirus Uncharacterized protein HVLF2 (US16) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Uncharacterized protein HVLF2

UniProt

P09717

Expression Region

1-309

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLRFPTATQRQIVFRRLFDSGNNDDYDEAAVVAVLGWVHRFEVVVRIAGLLLFQISAAV AVLGSFSLVFPTATLKSRPGFPCHVVWAPEVLLLVPVASALFVYFRYERPVLAQRNRHPR CRRPFRQLVLLLAGLLAHIPALGVTCACQEPREVLTSFVLTLVITLLCAEVVFICRDNCT LSDQFTLINGVWVVVFLVNVLIVFTRPWTWPLRLLLGFYSTVGLIFAGHFSQQVLFVRHV LMPRDVAHTSLQLFITFISLFFLILRIRNCQDLLSDLRLLELPSSDAMTLTPNDLSHASS STPLSTLSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (LAMP3/968), CF488A conjugate, 0.1mg/mL
BNC880968-100 1x 100 µL

CD63 (LAMP3/968), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat Valosin Containing Protein (VCP) ELISA Kit
RDR-VCP-Ra-01 96 Tests

Rat Valosin Containing Protein (VCP) ELISA Kit

Sign In for Pricing
View Details
Rat Valosin Containing Protein (VCP) ELISA Kit
RDR-VCP-Ra-02 48 Tests

Rat Valosin Containing Protein (VCP) ELISA Kit

Sign In for Pricing
View Details
Renalase (Renal Cell Marker) (RNLS/1940), CF640R conjugate, 0.1mg/mL
BNC401940-500 1x 500 µL

Renalase (Renal Cell Marker) (RNLS/1940), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDHD3 Mouse Monoclonal Antibody [Clone ID: OTI2A8]
CF811492 100 µg

HDHD3 Mouse Monoclonal Antibody [Clone ID: OTI2A8]

Sign In for Pricing
View Details
DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 2F11G1]
AM06227SU-N 100 µL

DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 2F11G1]

Sign In for Pricing
View Details