Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Taste receptor type 2 member 64 (TAS2R64)

This Recombinant Pan paniscus Taste receptor type 2 member 64 (TAS2R64) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 64, T2R64

UniProt

Q5Y4Y9

Expression Region

1-309

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYFLLIILSILVVFAFVLGNFSNGFVALVNVIDWVKTRKISSADQILTALVVSRIGLLW VILFHWYANVFNSALYSSEVGAVASNISAIINHFSIWLAASLGIFYLLKIANFSNLIFLH LKKRIRSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSDLTVS TLANLIPFILTLICFLLLICSLHKHLKKMQLHGKGSQDLSTKVHIKALQTVISFLMLYAI YFLYLITLTWNLWTQQNKLVFLLCQTLGIMYPSFHSFFLIMGSRKLKQTFLSVLCQVTCL VKGQQPSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-100 1x 100 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (2D2), CF594 conjugate, 0.1mg/mL
BNC940004-100 1x 100 µL

Bax (2D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF740 conjugate, 0.1mg/mL
BNC740822-100 1x 100 µL

P21 / WAF1 (DCS-60.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF647 conjugate, 0.1mg/mL
BNC472217-100 1x 100 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details