Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Taste receptor type 2 member 8 (TAS2R8)

This Recombinant Pongo pygmaeus Taste receptor type 2 member 8 (TAS2R8) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 8, T2R8

UniProt

Q645U8

Expression Region

1-309

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTTDYILTNLVISRICLIS VIVVNGIVTVLYPDVYTKSKLQIAISTFWTFANYLNMWFTTCLNVFYFLKIANSSHPLFL WLKQKIDMVVRWILLGCFAISLLVSLIIAIVLSRDYRFHAIAKHKRNITEMFHVSKMLYF EPLTLFNLLAIVPFIVSLMSFFLLVRSLQRHTKQIKLYATGGRDPSTEAHVRAIKTMTSF IFFFFLYYITSLLVTFSYLMTKYKLAMAFGEIVAILYPSGHSFILIILNNKLRQASVRML TCIKITCVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (MF9), CF640R conjugate, 0.1mg/mL
BNC400644-100 1x 100 µL

TGFalpha (MF9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), CF740 conjugate, 0.1mg/mL
BNC741014-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (C5/473 + CD5/54/F6), CF568 conjugate, 0.1mg/mL
BNC680748-500 1x 500 µL

CD5 (C5/473 + CD5/54/F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), CF488A conjugate, 0.1mg/mL
BNC881098-500 1x 500 µL

Cyclin B1 (CCNB1/1098), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details