Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Taste receptor type 2 member 8 (TAS2R8)

This Recombinant Pan troglodytes Taste receptor type 2 member 8 (TAS2R8) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 8, T2R8

UniProt

Q646C5

Expression Region

1-309

Origin

Pan troglodytes (Chimpanzee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLIS VMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFXVSKIPYF EPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF IFFFFLYFISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQIFVRML TCRKIACVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-500 1x 500 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL
BNC042873-100 1x 100 µL

CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF594 conjugate, 0.1mg/mL
BNC941777-100 1x 100 µL

Prostate Specific Antigen (PSA) (3E6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details