Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6X1 (OR6X1)

This Recombinant Human Olfactory receptor 6X1 (OR6X1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6X1, Olfactory receptor OR11-270

UniProt

Q8NH79

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNGTVITEFILLGFPVIQGLQTPLFIAIFLTYILTLAGNGLIIATVWAEPRLQIPMYFF LCNLSFLEIWYTTTVIPKLLGTFVVARTVICMSCCLLQAFFHFFVGTTEFLILTIMSFDR YLTICNPLHHPTIMTSKLCLQLALSSWVVGFTIVFCQTMLLIQLPFCGNNVISHFYCDVG PSLKAACIDTSILELLGVIATILVIPGSLLFNMISYIYILSAILRIPSATGHQKTFSTCA SHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKGALR KAMTCPKTGHAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR4 (NM_033661) Human Recombinant Protein
TP317569L 1 mg

WDR4 (NM_033661) Human Recombinant Protein

Sign In for Pricing
View Details
2-Debenzoyl-2-tigloyl 10-Deacetyl Baccatin III
TRC-D203500-10MG 10 mg

2-Debenzoyl-2-tigloyl 10-Deacetyl Baccatin III

Sign In for Pricing
View Details
CD117 (Cocktail), CF640R conjugate, 0.1mg/mL
BNC401018-500 1x 500 µL

CD117 (Cocktail), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDKN1A interacting zinc finger protein 1 (CIZ1) Human Gene Knockout Kit (CRISPR)
KN223437RB 1 Kit

CDKN1A interacting zinc finger protein 1 (CIZ1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mix-n-StainTM CF®660C Antibody Labeling Kit, 1x (20-50ug) labeling
#92260 1 Kit

Mix-n-StainTM CF®660C Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Atp2a2 Mouse Gene Knockout Kit (CRISPR)
KN501777 1 Kit

Atp2a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details