Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6X1 (OR6X1)

This Recombinant Human Olfactory receptor 6X1 (OR6X1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6X1, Olfactory receptor OR11-270

UniProt

Q8NH79

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNGTVITEFILLGFPVIQGLQTPLFIAIFLTYILTLAGNGLIIATVWAEPRLQIPMYFF LCNLSFLEIWYTTTVIPKLLGTFVVARTVICMSCCLLQAFFHFFVGTTEFLILTIMSFDR YLTICNPLHHPTIMTSKLCLQLALSSWVVGFTIVFCQTMLLIQLPFCGNNVISHFYCDVG PSLKAACIDTSILELLGVIATILVIPGSLLFNMISYIYILSAILRIPSATGHQKTFSTCA SHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKGALR KAMTCPKTGHAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DOG1.1]
AM10078SU-N 1 mL

TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DOG1.1]

Sign In for Pricing
View Details
Chloro- (2'-chloro) trityl Polystyrene
H50056033.25G 25 g

Chloro- (2'-chloro) trityl Polystyrene

Sign In for Pricing
View Details
Recombinant Rat IL-6 Protein (Sumo Tag)
PDER100246-01 20 µg

Recombinant Rat IL-6 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat IL-6 Protein (Sumo Tag)
PDER100246-02 100 µg

Recombinant Rat IL-6 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat IL-6 Protein (Sumo Tag)
PDER100246-03 500 µg

Recombinant Rat IL-6 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat IL-6 Protein (Sumo Tag)
PDER100246-04 1 mg

Recombinant Rat IL-6 Protein (Sumo Tag)

Sign In for Pricing
View Details