Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C2 (OR6C2)

This Recombinant Human Olfactory receptor 6C2 (OR6C2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C2, HSA3

UniProt

Q9NZP2

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFF LRNFSFLEVSFTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR YVAICKPLHYVVIMNNRVCTLLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAG PLLKISCSDTWVIEQMVILMAVFALIITLVCVILSYLYIVRTILKFPSVQQRKKAFSTCS SHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS DSIKRIAFLSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CM chremrose 6FF
C15160-01 100 mL

CM chremrose 6FF

Sign In for Pricing
View Details
CM chremrose 6FF
C15160-02 500 mL

CM chremrose 6FF

Sign In for Pricing
View Details
[Dihydro-Pro4, 3,5-Di-Br-Tyr6]-Obestatin (Human, Monkey)
031-27 100 µg

[Dihydro-Pro4, 3,5-Di-Br-Tyr6]-Obestatin (Human, Monkey)

Sign In for Pricing
View Details
Recombinant ASFV EP153R Protein, N-His
orb3055384-01 50 µg

Recombinant ASFV EP153R Protein, N-His

Sign In for Pricing
View Details
Recombinant ASFV EP153R Protein, N-His
orb3055384-02 100 µg

Recombinant ASFV EP153R Protein, N-His

Sign In for Pricing
View Details
Recombinant ASFV EP153R Protein, N-His
orb3055384-03 1 mg

Recombinant ASFV EP153R Protein, N-His

Sign In for Pricing
View Details