Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C2 (OR6C2)

This Recombinant Human Olfactory receptor 6C2 (OR6C2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 6C2, HSA3

UniProt

Q9NZP2

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFF LRNFSFLEVSFTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR YVAICKPLHYVVIMNNRVCTLLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAG PLLKISCSDTWVIEQMVILMAVFALIITLVCVILSYLYIVRTILKFPSVQQRKKAFSTCS SHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS DSIKRIAFLSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUTF2 Antibody
A18846-50UG 50 µg

NUTF2 Antibody

Sign In for Pricing
View Details
Endogl1 Peptide - N-terminal region
MBS3233210-01 0.1 mg

Endogl1 Peptide - N-terminal region

Sign In for Pricing
View Details
Endogl1 Peptide - N-terminal region
MBS3233210-02 5x 0.1 mg

Endogl1 Peptide - N-terminal region

Sign In for Pricing
View Details
Lhx4 3'UTR Luciferase Stable Cell Line
TU111044 1.0 mL

Lhx4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GPC1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0886404 1.0 µg DNA

GPC1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
FBXO16 Peptide
orb2013616 100 µg

FBXO16 Peptide

Sign In for Pricing
View Details