Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 1D2 (OR1D2)

This Recombinant Pan troglodytes Olfactory receptor 1D2 (OR1D2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D2

UniProt

Q9TUA8

Expression Region

1-312

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSCLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVALDNLILAVMAY DRYVAICCPLHYTTAMSPKLCILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCE MYVLLRMACSNIQTNHTVLIATGCFIFLIPFGFVIISYVLIIRAILRIPSLSKKYKAFST CASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL GRLLDKHFKRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Antibody
abx038233-01 100 µg

Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Antibody
abx038233-02 1 mg

Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Antibody

Sign In for Pricing
View Details
ZNF821 Peptide - N-terminal region (AAP39286)
AAP39286-100UG 100 µg

ZNF821 Peptide - N-terminal region (AAP39286)

Sign In for Pricing
View Details
WNK4 (Serine/threonine-protein Kinase WNK4, Protein Kinase Lysine-deficient 4, Protein Kinase with No Lysine 4, PRKWNK4, PHA2B) (AP)
MBS6134574-01 0.1 mL

WNK4 (Serine/threonine-protein Kinase WNK4, Protein Kinase Lysine-deficient 4, Protein Kinase with No Lysine 4, PRKWNK4, PHA2B) (AP)

Sign In for Pricing
View Details
WNK4 (Serine/threonine-protein Kinase WNK4, Protein Kinase Lysine-deficient 4, Protein Kinase with No Lysine 4, PRKWNK4, PHA2B) (AP)
MBS6134574-02 5x 0.1 mL

WNK4 (Serine/threonine-protein Kinase WNK4, Protein Kinase Lysine-deficient 4, Protein Kinase with No Lysine 4, PRKWNK4, PHA2B) (AP)

Sign In for Pricing
View Details
Usp35 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3037105 3x 1.0 µg

Usp35 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details