Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51B6 (OR51B6)

This Recombinant Human Olfactory receptor 51B6 (OR51B6) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 51B6, Odorant receptor HOR5'beta6

UniProt

Q9H340

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLNKSASTFQLTGFPGMEKAHHWIFIPLLAAYISILLGNGTLLFLIRNDHNLHEPMYYF LAMLAATDLGVTLTTMPTVLGVLWLDHREIGHGACFSQAYFIHTLSVMESGVLLAMAYDC FITIRSPLRYTSILTNTQVMKIGVRVLTRAGLSIMPIVVRLHWFPYCRSHVLSHAFCLHQ DVIKLACADITFNRLYPVVVLFAMVLLDFLIIFFSYILILKTVMGIGSGGERAKALNTCV SHICCILVFYVTVVCLTFIHRFGKHVPHVVHITMSYIHFLFPPFMNPFIYSIKTKQIQSG ILRLFSLPHSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nadunolimab Biosimilar - Research Grade
ICH5088-100mg 100 mg

Nadunolimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Mouse Akr1e1 activation kit by CRISPRa
GA205815 1 Kit

Mouse Akr1e1 activation kit by CRISPRa

Sign In for Pricing
View Details
alpha Tubulin (TUBA4A) Goat Polyclonal Antibody
AB0046-200 400 µg

alpha Tubulin (TUBA4A) Goat Polyclonal Antibody

Sign In for Pricing
View Details
ATF1 (NM_005171) Human Over-expression Lysate
LC401582 20 µg

ATF1 (NM_005171) Human Over-expression Lysate

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF640R conjugate, 0.1mg/mL
BNC402010-500 1x 500 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cd40lg Hamster Monoclonal Antibody [Clone ID: MR1]
AM08043FC-N 500 µg

Cd40lg Hamster Monoclonal Antibody [Clone ID: MR1]

Sign In for Pricing
View Details