Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51B5 (OR51B5)

This Recombinant Human Olfactory receptor 51B5 (OR51B5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 51B5, Odorant receptor HOR5'beta5, Olfactory receptor OR11-37

UniProt

Q9H339

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKEDHNLHEPMYFF LAMLAATDLGLALTTMPTVLGVLWLDHREIGSAACFSQAYFIHSLSFLESGILLAMAYDR FIAICNPLRYTSVLTNTRVVKIGLGVLMRGFVSVVPPIRPLYFFLYCHSHVLSHAFCLHQ DVIKLACADTTFNRLYPAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCV SHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLIMSYAYFLFPPLMNPITYSVKTKQIQNA ILHLFTTHRIGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SREBP-1 shRNA Plasmid (r)
sc-156126-SH 20 µg

SREBP-1 shRNA Plasmid (r)

Sign In for Pricing
View Details
Lentiviral mouse Oma1 shRNA (UAS) - Lentiviral mouse Oma1 shRNA (UAS) (25)
GTR15288413 1 Vial

Lentiviral mouse Oma1 shRNA (UAS) - Lentiviral mouse Oma1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Porcine SCO spondin (SSPO) ELISA kit
GTR10473615 96 Well

Porcine SCO spondin (SSPO) ELISA kit

Sign In for Pricing
View Details
TIGD7 Antibody, Biotin conjugated
A58873-50UG 50 µg

TIGD7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant human IL-13 protein, C-His (HEK293)
bs-43087P-01 20 µg

Recombinant human IL-13 protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human IL-13 protein, C-His (HEK293)
bs-43087P-02 100 µg

Recombinant human IL-13 protein, C-His (HEK293)

Sign In for Pricing
View Details