Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51I2 (OR51I2)

This Recombinant Human Olfactory receptor 51I2 (OR51I2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 51I2, Odorant receptor HOR5'beta12, Olfactory receptor OR11-38

UniProt

Q9H344

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLFNVTHPAFFLLTGIPGLESSHSWLSGPLCVMYAVALGGNTVILQAVRVEPSLHEPMY YFLSMLSFSDVAISMATLPTVLRTFCLNARNITFDACLIQMFLIHFFSMMESGILLAMSF DRYVAICDPLRYATVLTTEVIAAMGLGAAARSFITLFPLPFLIKRLPICRSNVLSHSYCL HPDMMRLACADISINSIYGLFVLVSTFGMDLFFIFLSYVLILRSVMATASREERLKALNT CVSHILAVLAFYVPMIGVSTVHRFGKHVPCYIHVLMSNVYLFVPPVLNPLIYSAKTKEIR RAIFRMFHHIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC17A9 Antibody Picoband® Fluoro647 Conjugated
A07501-1-Fluoro647 100 µg/Vial

Anti-SLC17A9 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit
MBS450082-01 48 Tests

Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit

Sign In for Pricing
View Details
Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit
MBS450082-02 96 Tests

Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit

Sign In for Pricing
View Details
Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit
MBS450082-03 5x 96 Tests

Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit

Sign In for Pricing
View Details
Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit
MBS450082-04 10x 96 Tests

Rat Heat Shock 60kD Protein 1, Chaperonin (HSPD1) ELISA Kit

Sign In for Pricing
View Details
TRMT12 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
47867156 3x 1.0 µg DNA

TRMT12 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details