Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 1D5 (OR1D5)

This Recombinant Pan troglodytes Olfactory receptor 1D5 (OR1D5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D5

UniProt

Q9TUA6

Expression Region

1-312

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSRLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVFYGLLLTLLLTRVTFCGPREIHYLFCD MYILLRLACSNTHIIHTVLVATGCFIFLTPLGFMTTSYVRIVRTILQIPSASKKYKAFST CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVVTPMMNPFIHSLRNKDMHGAL GRVLRRLFQRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HCK Antibody
RC-5734-01 50 μL

Recombinant HCK Antibody

Sign In for Pricing
View Details
Recombinant HCK Antibody
RC-5734-02 100 µL

Recombinant HCK Antibody

Sign In for Pricing
View Details
Recombinant HCK Antibody
RC-5734-03 1 mL

Recombinant HCK Antibody

Sign In for Pricing
View Details
CoCoA (CALCOCO1) Rabbit Polyclonal Antibody
TA366054 100 µL

CoCoA (CALCOCO1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human NARS2 activation kit by CRISPRa
GA112585 1 Kit

Human NARS2 activation kit by CRISPRa

Sign In for Pricing
View Details
rac 2-Cyano-2-phenylbutanamide
TRC-C982106-250MG 250 mg

rac 2-Cyano-2-phenylbutanamide

Sign In for Pricing
View Details