Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 1D5 (OR1D5)

This Recombinant Pan troglodytes Olfactory receptor 1D5 (OR1D5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D5

UniProt

Q9TUA6

Expression Region

1-312

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSRLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVFYGLLLTLLLTRVTFCGPREIHYLFCD MYILLRLACSNTHIIHTVLVATGCFIFLTPLGFMTTSYVRIVRTILQIPSASKKYKAFST CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVVTPMMNPFIHSLRNKDMHGAL GRVLRRLFQRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit
MBS9396635-01 48 Well

Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit

Sign In for Pricing
View Details
Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit
MBS9396635-02 96 Well

Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit

Sign In for Pricing
View Details
Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit
MBS9396635-03 5x 96 Well

Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit

Sign In for Pricing
View Details
Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit
MBS9396635-04 10x 96 Well

Canine Soluble Toll Like Receptor 9 (STLR9) ELISA Kit

Sign In for Pricing
View Details
Anti-CD16α aptamer
CTApt-2043 10 nmol

Anti-CD16α aptamer

Sign In for Pricing
View Details
Human ADP-Ribosylation Factor-like Protein 1 (ARL1) AssayLite Antibody (FITC, RPE, APC, PerCP Conjugate)
30173-05181 1x 75 µg - 3x 30 µg

Human ADP-Ribosylation Factor-like Protein 1 (ARL1) AssayLite Antibody (FITC, RPE, APC, PerCP Conjugate)

Sign In for Pricing
View Details