Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 1D5 (OR1D5)

This Recombinant Pan troglodytes Olfactory receptor 1D5 (OR1D5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D5

UniProt

Q9TUA6

Expression Region

1-312

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSRLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVFYGLLLTLLLTRVTFCGPREIHYLFCD MYILLRLACSNTHIIHTVLVATGCFIFLTPLGFMTTSYVRIVRTILQIPSASKKYKAFST CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVVTPMMNPFIHSLRNKDMHGAL GRVLRRLFQRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BMI-1 Antibody (LLBmi1-1) [mFluor Violet 610 SE]
NBP1-96140MFV610 0.1 mL

Mouse Monoclonal BMI-1 Antibody (LLBmi1-1) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal DGK-zeta Antibody [FITC]
NBP2-97260F 0.1 mL

Rabbit Polyclonal DGK-zeta Antibody [FITC]

Sign In for Pricing
View Details
PTRF Conjugated Antibody
orb1622598 100 µL

PTRF Conjugated Antibody

Sign In for Pricing
View Details
MRSD-set siRNA/shRNA/RNAi Lentivector (Human)
30614091 4x 500 ng

MRSD-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Immortalized Canine Brain Microvascular Endothelial Cells (CBrMEC)
T0835 1x106 cells / 1.0 mL

Immortalized Canine Brain Microvascular Endothelial Cells (CBrMEC)

Sign In for Pricing
View Details
MT1E ELISA Kit (Human)
OKCD08538-96W 96 Well

MT1E ELISA Kit (Human)

Sign In for Pricing
View Details