Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2J1 (OR2J1)

This Recombinant Human Olfactory receptor 2J1 (OR2J1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2J1, Hs6M1-4, Olfactory receptor 6-5, OR6-5

UniProt

Q9GZK6

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMKKNASFEDFFLLLGFSNWPHLEVVLFVVILIFYLITLIGNLFIIILSYLDSHLHTPM YFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCTVQLYFVLALGTAECVLLVVMS YDRYAAVCRPLHYTVLMHPRFCRLLAAASWVSGFTTSALHSSFTFWIPLCRHRLVDHFFC EVPALLRLSCVDTQANELTLMVMSSIFVLIPLILILTSYGAIARAVLSMQSTTGLQKVLR TCGAHLMVVSLFFIPVMCMYLQPPSENSQDQGKFIALFYTVVTPSLNPLIYTFRNKDVRG AVKRLMGWEWGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 (NM_001130145) Human Tagged Lenti ORF Clone
RC225864L3 10 µg

YAP1 (NM_001130145) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-SUSD6 Antibody Picoband®, Cy3 Conjugate
A14613-1-Cy3 100 µg/Vial

Anti-SUSD6 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Rat Rabl2 Pre-designed siRNA Set A
SI211541A 1 Each

Rat Rabl2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PSIP fragment protein (His tag only)
80-1384HIS 1 mg

PSIP fragment protein (His tag only)

Sign In for Pricing
View Details
Human NOL3 Recombinant Protein (N-GST & C-His)
HF768022-01 50 µg

Human NOL3 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Human NOL3 Recombinant Protein (N-GST & C-His)
HF768022-02 100 µg

Human NOL3 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details